PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G05160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 311aa    MW: 33592.1 Da    PI: 9.7149
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G05160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.6e-181661147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v ++G ++W++I++ ++ gR++k+c++rw + 
  OMERI08G05160.1 16 KGPWSPEEDEALQRLVGRHGARNWSLISKSIP-GRSGKSCRLRWCNQ 61
                     79******************************.***********985 PP

2Myb_DNA-binding52.89.2e-1770112347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  OMERI08G05160.1  70 PFTPEEDDTILRAHARFGNK-WATIARLLA-GRTDNAIKNHWNST 112
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.1881166IPR017930Myb domain
SuperFamilySSF466899.73E-3213109IPR009057Homeodomain-like
SMARTSM007174.0E-161564IPR001005SANT/Myb domain
PfamPF002497.0E-181661IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-261769IPR009057Homeodomain-like
CDDcd001671.28E-151860No hitNo description
SMARTSM007179.0E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129420.81468117IPR017930Myb domain
CDDcd001675.65E-1270113No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2370116IPR009057Homeodomain-like
PfamPF002492.2E-1470112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000031Biological Processregulation of salicylic acid mediated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MASCRRGGGG DVDRIKGPWS PEEDEALQRL VGRHGARNWS LISKSIPGRS GKSCRLRWCN  60
QLSPQVEHRP FTPEEDDTIL RAHARFGNKW ATIARLLAGR TDNAIKNHWN STLKRKHHSS  120
ASLLTDDLRP LKRTTSDGHP TLSSAAAPGS PSGSDLSDSS NHMPSSPSPP HQHLPLPQHV  180
YRPVARAGGV VVPPPPPLPP PPATSLSLSL SLPGLDDPHP DPSTPSEPAV QLQPPPPSQM  240
PPPTPSCVRQ EPPQMPPPPT PFSAEFLAMM QEMIRIEVRN YMSGSAAVDA RPPPDNGVRA  300
ASRIMGMAKI E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-39131164107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00596DAPTransfer from AT5G67300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0661410.0AK066141.1 Oryza sativa Japonica Group cDNA clone:J013055K23, full insert sequence.
GenBankAP0058210.0AP005821.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OSJNBa0094B20.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612590.11e-158PREDICTED: transcription factor MYB44
SwissprotQ9FDW19e-83MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0E0EIT30.0A0A0E0EIT3_9ORYZ; Uncharacterized protein
STRINGORGLA09G0002900.11e-159(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-65myb domain protein r1